Overview

  • Product name
    Anti-PKN2 antibody - C-terminal
    See all PKN2 primary antibodies
  • Description
    Rabbit polyclonal to PKN2 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide within Mouse PKN2 aa 891-940 (C terminal). The exact sequence is proprietary. (NP_848769).
    Sequence:

    LRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGRE


    Database link: Q8BWW9

  • Positive control
    • Mouse thymus lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 2% Sucrose, 98% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 112 kDa.

Target

  • Function
    Exhibits a preference for highly basic protein substrates.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 C2 domain.
    Contains 1 protein kinase domain.
    Contains 3 REM (Hr1) repeats.
  • Domain
    The C1 domain does not bind the diacylglycerol (DAG).
  • Post-translational
    modifications
    Autophosphorylated.
    Activated by limited proteolysis with trypsin.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cardiolipin activated protein kinase Pak2 antibody
    • MGC150606 antibody
    • MGC71074 antibody
    • PAK 2 antibody
    • PAK2 antibody
    • PKN gamma antibody
    • PKN2 antibody
    • PKN2_HUMAN antibody
    • PRK2 antibody
    • PRKCL2 antibody
    • PRO2042 antibody
    • Protein kinase C like 2 antibody
    • Protein kinase C related kinase 2 antibody
    • Protein kinase C-like 2 antibody
    • Protein kinase N2 antibody
    • Protein-kinase C-related kinase 2 antibody
    • Serine/threonine-protein kinase N2 antibody
    see all

Images

  • Anti-PKN2 antibody - C-terminal (ab177322) at 1 µg/ml + Mouse thymus lysate at 10 µg

    Predicted band size: 112 kDa

References

ab177322 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up