Overview

  • Product name
    Anti-PLA2G4D antibody
  • Description
    Rabbit polyclonal to PLA2G4D
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human PLA2G4D aa 1-216.
    Sequence:

    MGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWYDLTSSGESWKQHIKDKT RSLEKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQRSPNFLQ GLQLHQDYCSHKDFSTWADYQLDSMPSQLTPKEPRLCLVDAAYFINTSSP SMFRPGRRLDLILSFDYSLSAPFEVPWSPQGNPSAQPGQAPEASSRATEP LPHTARVPKGRRGVRP


    Database link: AAH34571.1

  • Positive control
    • PLA2G4D transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab173395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa.

Target

  • Function
    Calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position. Not arachidonic acid-specific but has linoleic acid-specific activity. May play a role in inflammation in psoriatic lesions.
  • Tissue specificity
    Expressed in stratified squamous epithelia, such as those in skin and cervix, but not in other tissues. Strongly expressed in the upper spinous layer of the psoriatic epidermis, expressed weakly and discontinuously in atopic dermatitis and mycosis fungoides, and not detected in the epidermis of normal skin.
  • Sequence similarities
    Contains 1 C2 domain.
    Contains 1 PLA2c domain.
  • Domain
    The N-terminal C2 domain associates with lipid membranes upon calcium binding. It modulates enzyme activity by presenting the active site to its substrate in response to elevations of cytosolic Ca(2+).
  • Cellular localization
    Cytoplasm > cytosol. Cytoplasmic vesicle membrane. Translocates to membrane vesicles in a calcium-dependent fashion. Translocates to perinuclear regions upon ionomycin stimulation.
  • Information by UniProt
  • Database links
  • Alternative names
    • cPLA2 delta antibody
    • cPLA2-delta antibody
    • cPLA2delta antibody
    • Cytosolic phospholipase A2 delta antibody
    • PA24D_HUMAN antibody
    • Phospholipase A2 group IVD antibody
    • phospholipase A2, group IVD (cytosolic) antibody
    • Pla2g4d antibody
    see all

Images

  • All lanes : Anti-PLA2G4D antibody (ab173395) at 1 µg/ml

    Lane 1 : PLA2G4D transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Goat anti-Rabbit IgG at 1/7500 dilution

    Predicted band size : 24 kDa

    MW of immunogen ~24 kDa.

References

ab173395 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up