Overview

  • Product nameAnti-PLAC9 antibody
  • Description
    Rabbit polyclonal to PLAC9
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 48-97 of Human PLAC9 (

    RLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF

    ) NP_001012991

  • Positive control
    • Fetal heart lysate (Human)

Properties

Applications

Our Abpromise guarantee covers the use of ab86234 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 10 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-PLAC9 antibody images

  • Anti-PLAC9 antibody (ab86234) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal heart lysate (Human) at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 10 kDa
    Observed band size : 10 kDa

References for Anti-PLAC9 antibody (ab86234)

ab86234 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86234.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"