Anti-Placental Protein 14 / Glycodelin A antibody (ab189873)

Overview

  • Product name
    Anti-Placental Protein 14 / Glycodelin A antibody
    See all Placental Protein 14 / Glycodelin A primary antibodies
  • Description
    Rabbit polyclonal to Placental Protein 14 / Glycodelin A
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Placental Protein 14/ Glycodelin A aa 19-180. Mature Placental Protein 14/ Glycodelin A
    Sequence:

    MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTP EDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYD NFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYL LDLKQMEEPCRF


    Database link: P09466

  • Positive control
    • U937 and 293T cell line extracts.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab189873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 21 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function
    This protein is, quantitatively, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy.
  • Sequence similarities
    Belongs to the calycin superfamily. Lipocalin family.
  • Post-translational
    modifications
    At least two differentially glycosylated forms are found. Glycodelin-A (GdA) (amniotic fluid) with contraceptive and immunosuppressive activities and glycodelin-S (Gds) (seminal plasma) whose role is not yet known. The gender-specific glycosylation may serve to regulate key process involved in human reproduction.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Alpha uterine protein antibody
    • gD antibody
    • GdA antibody
    • GdF antibody
    • GdS antibody
    • Glycodelin A antibody
    • Glycodelin antibody
    • Glycodelin F antibody
    • Glycodelin S antibody
    • MGC138509 antibody
    • MGC142288 antibody
    • PAEG antibody
    • PAEP antibody
    • PAEP_HUMAN antibody
    • PEG antibody
    • PEP antibody
    • Placental protein 14 antibody
    • PP14 antibody
    • Pregnancy-associated endometrial alpha-2 globulin antibody
    • Progestagen-associated endometrial protein antibody
    • Progesterone-associated endometrial protein antibody
    see all

Images

  • All lanes : Anti-Placental Protein 14 / Glycodelin A antibody (ab189873) at 1/500 dilution

    Lane 1 : U937 cell line extract
    Lane 2 : 293T cell line extract


    Predicted band size : 21 kDa

References

ab189873 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up