Overview

  • Product name
    Anti-PLD6 antibody - C-terminal
    See all PLD6 primary antibodies
  • Description
    Rabbit polyclonal to PLD6 - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human PLD6 aa 188-237 (C terminal). The exact sequence is proprietary. (NP_849158.2)
    Sequence:

    ITEDDEYVRLFLEEFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRL


    Database link: Q8N2A8

  • Positive control
    • Human fetal heart lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab177449 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa.

Target

  • Function
    Cardiolipin hydrolase present at the mitochondrial outer membrane required both for mitochondrial fusion and piRNA metabolic process. Acts by catalyzing the hydrolysis of cardiolipin (diphosphatidylglycerol) to form phosphatidate (phosphatidic acid or PA) at the mitochondrial outer membrane surface, promoting mitochondrial fusion. The production of phosphatidate also regulates the piRNA metabolic process by promoting recruitment and/or activation of components of the meiotic nuage, also named P granule, a critical step for primary biogenesis of piRNAs. Required during spermatogenesis to repress transposable elements and prevent their mobilization via its role in the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons.
  • Tissue specificity
    Widely expressed. Expression is not limites to testis and ovary.
  • Sequence similarities
    Belongs to the phospholipase D family. MitoPLD/Zucchini subfamily.
    Contains 1 PLD phosphodiesterase domain.
  • Domain
    In contrast to other members of the phospholipase D family, contains only one PLD phosphodiesterase domain, suggesting that it has a single half-catalytic and requires homodimerization to form a complete active site (PubMed:17028579).
  • Cellular localization
    Mitochondrion outer membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Choline phosphatase 6 antibody
    • Mitochondrial cardiolipin hydrolase antibody
    • Mitochondrial phospholipase antibody
    • MitoPLD antibody
    • Phosphatidylcholine hydrolyzing phospholipase D6 antibody
    • Phosphatidylcholine-hydrolyzing phospholipase D6 antibody
    • Phospholipase D family member 6 antibody
    • Phospholipase D6 antibody
    • PLD 6 antibody
    • pld6 antibody
    • PLD6_HUMAN antibody
    • Protein zucchini homolog antibody
    • ZUC antibody
    • Zucchini, Drosophila, homolog of antibody
    see all

Images

  • Anti-PLD6 antibody - C-terminal (ab177449) at 1 µg/ml + Human fetal heart lysate at 10 µg

    Predicted band size : 28 kDa

References

ab177449 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177449.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up