Overview

  • Product name
    Anti-PLPL5 antibody
  • Description
    Rabbit polyclonal to PLPL5
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PLPL5 aa 314-392.
    Sequence:

    LEAALKKACTRDPSRWARFWHSGPGQVLTYLLLPCTLPFEYIYFRSRRLV VWLPDVPADLWWMQGLLRNMALEVFSRTK


    Database link: Q7Z6Z6

  • Positive control
    • Human stomach tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.
  • Database links
  • Alternative names
    • 4833426H19Rik antibody
    • dJ388M5 antibody
    • dJ388M5.4 antibody
    • GS2 like protein antibody
    • GS2L antibody
    • Patatin like phospholipase domain containing 5 antibody
    • Patatin like phospholipase domain containing protein 5 antibody
    • PNPLA5 antibody
    see all

Images

  • Immunohistochemical analysis of Human stomach tissue labeling PLPL5 with an185513 at 1/50 dilution.

References

ab185513 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185513.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up