Overview

  • Product name
    Anti-PNMA3 antibody
  • Description
    Rabbit polyclonal to PNMA3
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal aa 360-409 (ITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR K) of Human PNMA3 (NP_037496).

  • Positive control
    • Human fetal lung lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90174 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Tissue specificity
    Expressed at high levels in the brain and testis. Expressed at lower levels in the heart, trachea and kidney.
  • Sequence similarities
    Belongs to the PNMA family.
    Contains 1 CCHC-type zinc finger.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt
  • Database links
  • Alternative names
    • MA3 antibody
    • MA5 antibody
    • MGC132756 antibody
    • MGC132758 antibody
    • Paraneoplastic antigen Ma3 antibody
    • Paraneoplastic cancer testis brain antigen antibody
    • Paraneoplastic Ma antigen 3 antibody
    • PNMA 3 antibody
    • PNMA3 antibody
    • PNMA3_HUMAN antibody
    see all

Images

  • Anti-PNMA3 antibody (ab90174) at 1 µg/ml + Human fetal lung lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 52 kDa
    Observed band size : 52 kDa
    Additional bands at : 65 kDa. We are unsure as to the identity of these extra bands.

References

ab90174 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab90174.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up