Overview

  • Product nameAnti-PNMA3 antibody
    See all PNMA3 primary antibodies
  • Description
    Rabbit polyclonal to PNMA3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal aa 360-409 (ITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR K) of Human PNMA3 (NP_037496).

  • Positive control
    • Human fetal lung lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90174 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Tissue specificityExpressed at high levels in the brain and testis. Expressed at lower levels in the heart, trachea and kidney.
  • Sequence similaritiesBelongs to the PNMA family.
    Contains 1 CCHC-type zinc finger.
  • Cellular localizationNucleus > nucleolus.
  • Information by UniProt
  • Database links
  • Alternative names
    • MA3 antibody
    • MA5 antibody
    • MGC132756 antibody
    • MGC132758 antibody
    • Paraneoplastic antigen Ma3 antibody
    • Paraneoplastic cancer testis brain antigen antibody
    • Paraneoplastic Ma antigen 3 antibody
    • PNMA 3 antibody
    • PNMA3 antibody
    • PNMA3_HUMAN antibody
    see all

Anti-PNMA3 antibody images

  • Anti-PNMA3 antibody (ab90174) at 1 µg/ml + Human fetal lung lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 52 kDa
    Observed band size : 52 kDa
    Additional bands at : 65 kDa. We are unsure as to the identity of these extra bands.

References for Anti-PNMA3 antibody (ab90174)

ab90174 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90174.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"