Overview

  • Product name
  • Description
    Rabbit polyclonal to POLE
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human POLE aa 1-370. This sequence corresponds to aa 1917-2286 fragment from Swissprot Q07864.
    Sequence:

    MDPSNYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEE AEESNVEDLLENNWNILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLR RSAPGSTPVRRRGASQLSQEAEGAVGALPGMITFSQDYVANELTQSFFTI TQKIQKKVTGSRNSTELSEMFPVLPGSHLLLNNPALEFIKYVCKVLSLDT NITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCRSYVLPEVICRSCNFCRD LDLCKDSSFSEDGAVLPQWLCSNCQAPYDSSAIEMTLVEVLQKKLMAFTL QDLVCLKCRGVKETSMPVYCSCAGDFALTIHTQVFMEQIGIFRNIAQHYG MSYLLETLEWLLQKNPQLGH


    Database link: AAH21559.1

  • Positive control
    • POLE-transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa.

Target

  • Function
    Participates in DNA repair and in chromosomal DNA replication.
  • Sequence similarities
    Belongs to the DNA polymerase type-B family.
  • Domain
    The DNA polymerase activity domain resides in the N-terminal half of the protein, while the C-terminus is necessary for complexing subunits B and C. The C-terminus may also regulate the catalytic activities of the enzyme.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • CRCS12 antibody
    • DKFZp434F222 antibody
    • DNA polymerase epsilon catalytic subunit A antibody
    • DNA polymerase epsilon catalytic subunit antibody
    • DNA polymerase II subunit A antibody
    • DPOE1_HUMAN antibody
    • EC 2.7.7.7 antibody
    • FILS antibody
    • FLJ21434 antibody
    • POLE antibody
    • POLE1 antibody
    • Polymerase (DNA directed) epsilon antibody
    • polymerase (DNA directed), epsilon, catalytic subunit antibody
    see all

Images

  • All lanes : Anti-POLE antibody (ab172081) at 1 µg/ml

    Lane 1 : POLE-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L) at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 42 kDa

References

ab172081 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up