Overview

  • Product nameAnti-POLR1B antibody
    See all POLR1B primary antibodies
  • Description
    Rabbit polyclonal to POLR1B
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Human POLR1B aa 1007-1056 (internal sequence). The exact sequence is proprietary.
    Sequence:

    SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD


    Database link: NP_061887

  • Positive control
    • ACHN cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab101977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 128 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionDNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol I is composed of mobile elements and RPA2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.
  • Sequence similaritiesBelongs to the RNA polymerase beta chain family.
  • Cellular localizationNucleus, nucleolus.
  • Information by UniProt
  • Database links
  • Alternative names
    • A127 antibody
    • DNA directed RNA polymerase I 135kDa polypeptide antibody
    • DNA directed RNA polymerase I antibody
    • DNA directed RNA polymerase I subunit RPA2 antibody
    • DNA-directed RNA polymerase I 135 kDa polypeptide antibody
    • DNA-directed RNA polymerase I subunit rpa2 antibody
    • FLJ10816 antibody
    • FLJ21921 antibody
    • MGC131780 antibody
    • OTTHUMP00000161989 antibody
    • OTTHUMP00000203643 antibody
    • OTTHUMP00000203645 antibody
    • POLR 1B antibody
    • polr1b antibody
    • Polymerase (RNA) I polypeptide B 128kDa antibody
    • Polymerase (RNA) I polypeptide B antibody
    • RNA polymerase I polypeptide B antibody
    • RNA polymerase I subunit 2 antibody
    • RPA 135 antibody
    • RPA116 antibody
    • RPA135 antibody
    • RPA2 antibody
    • RPA2_HUMAN antibody
    • Rpo1 2 antibody
    see all

Anti-POLR1B antibody images

  • Anti-POLR1B antibody (ab101977) at 1 µg/ml + ACHN cell lysate at 10 µg

    Predicted band size : 128 kDa
    6-18% SDS PAGE

References for Anti-POLR1B antibody (ab101977)

ab101977 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"