Overview

  • Product nameAnti-POLR3F antibody
    See all POLR3F primary antibodies
  • Description
    Rabbit polyclonal to POLR3F
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within middle amino acids 180-229 (

    LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE

    ) of Human POLR3F (NP_006457)

  • Positive control
    • 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab84667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 36 kDa (predicted molecular weight: 36 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionDNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. May direct RNA Pol III binding to the TFIIIB-DNA complex. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
  • Sequence similaritiesBelongs to the eukaryotic RPC34/RPC39 RNA polymerase subunit family.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DNA directed RNA polymerase III 39 kDa polypeptide antibody
    • DNA directed RNA polymerase III 39 kDa polypeptide F antibody
    • DNA directed RNA polymerase III subunit F antibody
    • DNA directed RNA polymerase III subunit RPC6 antibody
    • DNA directed RNA polymerases III 39 kDa polypeptide antibody
    • DNA-directed RNA polymerase III subunit F antibody
    • DNA-directed RNA polymerase III subunit RPC6 antibody
    • MGC13517 antibody
    • Polr3f antibody
    • Polymerase (RNA) III (DNA directed) polypeptide F antibody
    • RNA polymerase III 39 kDa subunit antibody
    • RNA polymerase III C39 subunit antibody
    • RNA polymerase III subunit C6 antibody
    • RPC 39 antibody
    • RPC 6 antibody
    • RPC39 antibody
    • RPC6 antibody
    • RPC6_HUMAN antibody
    see all

Anti-POLR3F antibody images

  • Anti-POLR3F antibody (ab84667) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 36 kDa
    Observed band size : 36 kDa

References for Anti-POLR3F antibody (ab84667)

ab84667 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"