Overview

  • Product name
    Anti-Polyserase1 antibody
  • Description
    Rabbit polyclonal to Polyserase1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Polyserase1 aa 105-175.
    Sequence:

    LEEELLQRGIRARLREHGISLAAYGTIVSAELTGRHKGPLAERDFKSGRC PGNSFSCGNSQCVTKVNPECD


    Database link: Q7Z410

  • Positive control
    • Human colon tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    Polyserase-1 is also known as TMPRSS9 (transmembrane serine proteinase-9), and polyserase protease 1. Polyserase1 was originally discovered in human liver as a mosaic serine proteinase with a type II transmembrane domain and three tandem repeats of serine proteinase domains. The domain structure of polyserase1 consists of a cytoplasmic domain, followed by a transmembrane domain, a “stem” region, an LDL receptor-like domain, and three serine proteinase domains. The third serine proteinase domain does not contain the canonical Gly-Asp-Ser-Gly-Gly residues found in the first two serase domains, and is not thought to be proteolytically active. Polyserase1 is found in greatest abundance in human liver, muscle, heart, placenta, and in fetal kidney and liver. Several human tumor cell lines also express significant amounts of polyserase1. Polyserase1 is a membrane associated protein, and the cleaved serase domains are thought to be retained on the cell surface by association with the propeptide domain, although the protein may also be found shed into conditioned culture media.
  • Cellular localization
    Cell Membrane; single pass type II membrane protein
  • Database links
  • Alternative names
    • EC 3.4.21.- antibody
    • Polyserase 1 antibody
    • Polyserase I antibody
    • Polyserine protease 1 antibody
    • TMPRSS9 antibody
    • Transmembrane protease, serine 9 antibody
    • Transmembrane serine protease 9 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling Polyserase1 with ab188037 at 1/200 dilution.

References

ab188037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up