
  • Product name
  • Description
    Chicken polyclonal to PON1
  • Host species
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Fusion protein: MYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIV, corresponding to amino acids 125-170 of PON1

  • Positive control
    • AEC staining method: Oral cancer epithelium


Our Abpromise guarantee covers the use of ab26930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/3000. Predicted molecular weight: 40 kDa.
ICC/IF 1/200.


  • Function
    Hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. Capable of hydrolyzing a broad spectrum of organophosphate substrates and lactones, and a number of aromatic carboxylic acid esters. Mediates an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.
  • Tissue specificity
    Plasma, associated with HDL (at protein level). Expressed in liver, but not in heart, brain, placenta, lung, skeletal muscle, kidney or pancreas.
  • Involvement in disease
    Genetic variation in PON1 is associated with susceptibility to microvascular complications of diabetes type 5 (MVCD5) [MIM:612633]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Note=Homozygosity for the Leu-54 allele is strongly associated with the development of retinal disease in diabetic patients.
  • Sequence similarities
    Belongs to the paraoxonase family.
  • Post-translational
    The signal sequence is not cleaved.
    Present in two forms, form B contains a disulfide bond, form A does not.
  • Cellular localization
    Secreted > extracellular space.
  • Information by UniProt
  • Database links
  • Alternative names
    • A esterase 1 antibody
    • A-esterase 1 antibody
    • Aromatic esterase 1 antibody
    • Arylesterase 1 antibody
    • Arylesterase B type antibody
    • ESA antibody
    • Esterase A antibody
    • K 45 antibody
    • K-45 antibody
    • MVCD5 antibody
    • Paraoxonase 1 antibody
    • Paraoxonase antibody
    • Paraoxonase B type antibody
    • Paraoxonase, plasma antibody
    • Paraoxonase1 antibody
    • PON 1 antibody
    • PON antibody
    • PON1 antibody
    • PON1_HUMAN antibody
    • Serum aryldiakylphosphatase antibody
    • Serum aryldialkylphosphatase 1 antibody
    • Serum paraoxonase/arylesterase 1 antibody
    see all


  • Anti-PON1 antibody (ab26930) at 1/3000 dilution + E. coli derived protein

    Goat anti IgY HRP at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 40 kDa
    Observed band size: 17 kDa (why is the actual band size different from the predicted?)


ab26930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Sorry for the long wait. I have another update about one of the products you previously enquired. ab26930: We have not tested this product for cross reactivity with PON2 and PON3. ab24261: There is no reply from the originator and I would as...

Read More


Sign up