Overview

  • Product name
    Anti-POP4 antibody
  • Description
    Rabbit polyclonal to POP4
  • Specificity
    This antibody reacts with POP4
  • Tested applications
    Suitable for: WB, IHC-P, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Zebrafish
  • Immunogen

    The region of Human POP4 from which the exact immunogen sequence was derived is amino acids 172-220 EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL . The exact sequence is proprietary information.

  • Positive control
    • HepG2 cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab50948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 28 kDa (predicted molecular weight: 25 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

Images

  • Lane 1 :
    Lane 2 : Anti-POP4 antibody (ab50948) at 1.25 µg/ml

    Lane 1 : MARKER
    Lane 2 : HepG2 cell lysate at 10 µg

    Secondary
    Lane 1 :
    Lane 2 : HRP conjugated anti-Rabbit IgG at 1/50000 dilution


    Predicted band size : 25 kDa
    Observed band size : 28 kDa (why is the actual band size different from the predicted?)
  • ab50948 at 4µg/ml staining POP4 in paraffin-embedded sections of human kidney tissue. Human alveolar cells are positively labelled (indicated with arrows). Magnification: 400x.

References

ab50948 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (Brain)
Loading amount
25 µg
Specification
Brain
Gel Running Conditions
Reduced Denaturing (10% gel)
Blocking step
Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Jun 29 2011

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up