Overview

  • Product name
  • Description
    Rabbit polyclonal to PORCN
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Full length protein corresponding to Human PORCN aa 1-450. (NP_073736.2).
    Sequence:

    MATFSRQEFFQQLLQGCLLPTAQQGLDQIWLLLAICLACRLLWRLGLPSY LKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLFLCRHSSHRGVFLS VTILIYLLMGEMHMVDTVTWHKMRGAQMIVAMKAVSLGFDLDRGEVGTVP SPVEFMGYLYFVGTIVFGPWISFHSYLQAVQGRPLSCRWLQKVARSLALA LLCLVLSTCVGPYLFPYFIPLNGDRLLRKWLRAYESAVSFHFSNYFVGFL SEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSY WLNNYVFKNALRLGTFSAVLVTYAASALLHGFSFHLAAVLLSLAFITYVE HVLRKRLARILSACVLSKRCPPDCSHQHRLGLGVRALNLLFGALAIFHLA YLGSLFDVDVDDTTEEQGYGMAYTVHKWSELSWASHWVTFGCWIFYRLIG


    Database link: Q9H237-4

  • Positive control
    • PORCN transfected 293T cell line lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172664 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 51 kDa.

Target

  • Function
    Modulates the processing of Wnt proteins. Probable protein-cysteine N-palmitoyltransferase that palmitoylates Wnt family members.
  • Tissue specificity
    Isoform 1 is expressed in fetal brain, brain, amygdala, caudate nucleus, cerebellum, hippocampus, pituitary, thalamus, heart, skeletal muscle and testis. Isoform 4 is expressed in amygdala, corpus callosum, hippocampus, spinal cord, kidney, liver, lung, spleen, uterus, testis. Isoform 2 and isoform 3 are expressed in substantia negra, spinal cord, heart and lung.
  • Involvement in disease
    Defects in PORCN are the cause of focal dermal hypoplasia (FODH) [MIM:305600]; also known as Goltz Gorlin syndrome. A rare congenital ectomesodermal disorder characterized by a combination of skin defects, skeletal abnormalities, and ocular anomalies. Affected individuals have patchy dermal hypoplasia, often in a distribution pattern following the Blaschko lines, and areas of subcutaneous fat herniation or deposition of fat into the dermis. In addition, sparse and brittle hair, hypoplastic nails and papillomas have been described. Skeletal abnormalities usually comprise syndactyly, ectrodactyly, and brachydactyly, and in some cases osteopathia striata has been seen. Patients frequently have ocular anomalies, including microphthalmia/ anophthalmia, coloboma, pigmentary and vascularization defects of the retina. Dental abnormalities are often present.
  • Sequence similarities
    Belongs to the membrane-bound acyltransferase family. Porcupine subfamily.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Form
    Cellular component Endoplasmic reticulum, Membrane. Modulates the processing of Wnt proteins. Probable protein-cysteine N-palmitoyltransferase that palmitoylates Wnt family members.
  • Alternative names
    • DHOF antibody
    • FODH antibody
    • MG61 antibody
    • MGC29687 antibody
    • por antibody
    • PORC antibody
    • PORCN antibody
    • PORCN_HUMAN antibody
    • PPN antibody
    • Probable protein-cysteine N-palmitoyltransferase porcupine antibody
    • Protein MG61 antibody
    see all

Images

  • All lanes : Anti-PORCN antibody (ab172664) at 1 µg/ml

    Lane 1 : PORCN transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat anti-Rabbit IgG (H+L) HRP at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 51 kDa

References

ab172664 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172664.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up