Overview

  • Product name
  • Description
    Rabbit polyclonal to PP1C gamma
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Xenopus laevis, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human PP1C gamma (N terminal).
    Sequence:

    DSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPL KICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVD


    Database link: BC014073

  • Positive control
    • WB: MDA-MB-435, HepG2, Jurkat and MCF-7 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab169976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 37 kDa.

Target

  • Function
    Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.
  • Sequence similarities
    Belongs to the PPP phosphatase family. PP-1 subfamily.
  • Cellular localization
    Cytoplasm. Nucleus. Nucleus > nucleolus. Nucleus > nucleoplasm. Nucleus speckle. Chromosome > centromere > kinetochore. Cleavage furrow. Midbody. Colocalizes with SPZ1 in the nucleus (By similarity). Rapidly exchanges between the nucleolar, nucleoplasmic and cytoplasmic compartments. Highly mobile in cells and can be relocalized through interaction with targeting subunits. In the presence of PPP1R8 relocalizes from the nucleolus to nuclear speckles. Shows a dynamic targeting to specific sites throughout the cell cycle. Highly concentrated in nucleoli of interphase cells and localizes at kinetochores early in mitosis. Relocalization to chromosome-containing regions occurs at the transition from early to late anaphase. Also accumulates at the cleavage furrow and midbody by telophase.
  • Information by UniProt
  • Database links
  • Alternative names
    • PP 1G antibody
    • PP-1G antibody
    • PP1C antibody
    • PP1G antibody
    • PP1G_HUMAN antibody
    • PP1gamma antibody
    • PPP 1G antibody
    • PPP1CC antibody
    • PPP1G antibody
    • Protein phosphatase 1, catalytic subunit, gamma isozyme antibody
    • Protein phosphatase 1C catalytic subunit antibody
    • Serine/threonine phosphatase 1 gamma antibody
    • Serine/threonine protein phosphatase PP1 gamma catalytic subunit antibody
    • Serine/threonine-protein phosphatase PP1-gamma catalytic subunit antibody
    see all

Images

  • All lanes : Anti-PP1C gamma antibody (ab169976) at 1/1000 dilution

    Lane 1 : MCF7 cell lysate
    Lane 2 : MDA-MB-435 cell lysate
    Lane 3 : HepG2 cell lysate
    Lane 4 : Jurkat cell lysate

    Predicted band size: 37 kDa

References

This product has been referenced in:
  • Mesman AW  et al. Measles virus suppresses RIG-I-like receptor activation in dendritic cells via DC-SIGN-mediated inhibition of PP1 phosphatases. Cell Host Microbe 16:31-42 (2014). Read more (PubMed: 25011106) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up