Overview

  • Product name
  • Description
    Rabbit polyclonal to PPFIBP1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Sheep, Rabbit, Horse, Cow, Cat, Dog, Pig, Chimpanzee, Rhesus monkey, Orangutan
  • Immunogen

    Synthetic peptide within Human PPFIBP1 aa 175-225. The exact sequence is proprietary. (NP_803193.2).
    Sequence:

    EISNLKLKLTAVEKDRLDYEDKFRDTEGLIQEINDLRLKVSEMDSERLQY E


    Database link: Q86W92

  • Positive control
    • HeLa, Jurkat, 293T, TCMK-1 and NIH/3T3 whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab195339 was affinity purified using an epitope specific to PPFIBP1 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab195339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 114 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • All lanes : Anti-PPFIBP1 antibody (ab195339) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate in NETN lysis buffer
    Lane 2 : 293T whole cell lysate in NETN lysis buffer
    Lane 3 : Jurkat whole cell lysate in NETN lysis buffer
    Lane 4 : TCMK-1 whole cell lysate in NETN lysis buffer
    Lane 5 : NIH/3T3 whole cell lysate in NETN lysis buffer

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 114 kDa


    Exposure time: 10 seconds
  • Detection of PPFIBP1 in Immunoprecipitates of 293T whole cell lysate prepared using NETN lysis buffer (1 mg for IP, 20% of IP loaded) using ab195339 at 6 µg/mg lysate for IP (Lane 1) and at 0.4 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 10 seconds.

References

ab195339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab195339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up