Overview

  • Product nameAnti-PPIL2 antibody
  • Description
    Rabbit polyclonal to PPIL2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 179-228 (

    MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP

    ) of Human PPIL2 (NP_055152).

  • Positive control
    • COLO205 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab98925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionPPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Tissue specificityHighest expression in thymus, pancreas and testis. Also detected in heart, placenta, lung, liver, skeletal muscle, kidney, spleen, prostate, ovary, small intestine and colon. Poorly detected in brain and leukocytes. Strong protein expression in lymph node (cortical, paracortical and medullar regions), thyroid (follicular epithelial cells), testis (developing spermatozoa), stomach (cells lining the gastric pit), pancreas, kidney (proximal and distal-tubule cells and collecting duct cells but not in glomeruli), endometrium and colon (goblet cells). Moderate protein expression in spleen, prostate (epithelium and squamous cell carcinomas), placenta and adrenal gland. Weak protein expression in liver, heart, breast, ovary, and lung. No protein expression in brain and bladder. High protein expression in most lymphomas and melanomas.
  • Sequence similaritiesBelongs to the cyclophilin-type PPIase family. PPIL2 subfamily.
    Contains 1 PPIase cyclophilin-type domain.
    Contains 1 U-box domain.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ39930 antibody
    • CYC4 antibody
    • Cyclophilin 60 antibody
    • Cyclophilin 60kDa antibody
    • Cyclophilin like protein Cyp 60 antibody
    • Cyclophilin-60 antibody
    • Cyclophilin-like protein Cyp-60 antibody
    • CYP60 antibody
    • hCyP 60 antibody
    • MGC33174 antibody
    • MGC787 antibody
    • Peptidyl prolyl cis trans isomerase like 2 antibody
    • Peptidyl-prolyl cis-trans isomerase-like 2 antibody
    • Peptidylprolyl cis trans isomerase antibody
    • Peptidylprolyl isomerase cyclophilin like 2 antibody
    • PPIase antibody
    • PPIL2 antibody
    • PPIL2_HUMAN antibody
    • Rotamase antibody
    • Rotamase PPIL2 antibody
    see all

Anti-PPIL2 antibody images

  • Anti-PPIL2 antibody (ab98925) at 1 µg/ml + COLO205 cell lysate at 10 µg

    Predicted band size : 59 kDa

References for Anti-PPIL2 antibody (ab98925)

ab98925 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"