Overview

  • Product name
  • Description
    Rabbit polyclonal to PPIL5
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PPIL5 aa 95-242.
    Sequence:

    AISSSLKGFLSAMRLAHRGCNVDTPVSTLTPVKTSEFENFKTKMVITSKK DYPLSKNFPYSLEHLQTSYCGLVRVDMRMLCLKSLRKLDLSHNHIKKLPA TIGDLIHLQELNLNDNHLESFSVALCHSTLQKSLRSLDLSKNKIKALP


    Database link: Q96L50

  • Positive control
    • Human fetal brain lysate, NIH-3T3 cell lysate, Human pancreas cancer tissue.

Properties

  • Form
    Lyophilised:Reconstitute in 200ul sterile water
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab169947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Detects a band of approximately 50 kDa (predicted molecular weight: 47 kDa).
IHC-P 1/100 - 1/500.

Target

  • Function
    May negatively regulate the 4-1BB-mediated signaling cascades which result in the activation of NK-kappaB and JNK1. Probable substrate recognition subunit of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Tissue specificity
    Ubiquitous. Maximal expression was seen in the heart and skeletal muscle and minimal expression seen in the kidney.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 7 LRR (leucine-rich) repeats.
  • Information by UniProt
  • Database links
  • Alternative names
    • 4 1BB mediated signaling molecule antibody
    • 4 1BBlrr antibody
    • 4-1BB-mediated-signaling molecule antibody
    • 4-1BBlrr antibody
    • Cyclophilin like 5 antibody
    • Leucine-rich repeat protein 1 antibody
    • LLR1_HUMAN antibody
    • LRR 1 antibody
    • LRR repeat protein 1 antibody
    • LRR-1 antibody
    • LRR-repeat protein 1 antibody
    • LRR1 antibody
    • MGC20689 antibody
    • peptidylprolyl isomerase (cyclophilin) like 5 antibody
    • Peptidylprolyl isomerase like 5 antibody
    • Peptidylprolyl isomerase-like 5 antibody
    see all

Images

  • All lanes : Anti-PPIL5 antibody (ab169947) at 1/500 dilution

    Lane 1 : Human fetal brain lysate
    Lane 2 : NIH-3T3 cell lysate


    Predicted band size : 47 kDa
  • Immunohistochemical analysis of Formalin/PFA-fixed paraffin-embedded Human pancreas cancer tissue labeling PPIL5 with ab169947 at 1/100 dilution

References

ab169947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up