Overview

  • Product nameAnti-PPP1R10 antibody
    See all PPP1R10 primary antibodies
  • Description
    Rabbit polyclonal to PPP1R10
  • Tested applicationsSuitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 350-400 (

    DRPGTPVPPVEVPELMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSV T

    ) of human PPP1R10 (SwissProt Q96QC0).

  • Positive control
    • Human breast adenocarcinoma.

Properties

Applications

Our Abpromise guarantee covers the use of ab84377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P
  • Application notesIHC-P: 1/100 - 1/500.
    Antigen exposure is recommended.
    Antigen exposure with citrate buffer will enhance staining.
    Likely to work with frozen sections.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • RelevancePPP1R10 (serine/threonine protein phosphatase 1 regulatory subunit 10), also known as PNUTS, is a targeting subunit of protein phosphatase 1 (PP1). Furthermore, PPP1R10 acts as an inhibitor of PPP1CA and PPP1CC phosphatase activities. Its inhibitory activity on PPP1CA is only observed when PPP1R10 is phosphorylated by Protein Kinase A (PKA). PPP1R10 contains a zinc finger motif and is predominantly localised within the nucleus. Recently, PPP1R10 has been shown to target PP1 to GABA(C) receptors, shuttling from the nucleus to the cell membrane in cells co-expressing this receptor. This highlights a role for this protein in the regulation of synaptic signal transduction. PPP1R10 has also been shown to regulate the activity of p53 in response to hypoxia.
    • Cellular localizationNucleus. Note: Found in discrete nucleoplasmic bodies and within nucleoli.
    • Database links
    • Alternative names
      • CAT 53 antibody
      • CAT53 antibody
      • FB 19 antibody
      • FB19 antibody
      • FB19 protein antibody
      • HLA-C associated transcript 53 antibody
      • MHC class I region proline rich protein CAT53 antibody
      • p99 antibody
      • Phosphatase 1 nuclear targeting subunit antibody
      • Phosphatase nuclear targeting subunit antibody
      • PNUTS antibody
      • PP1 binding protein of 114 kDa antibody
      • PP1 nuclear targeting subunit antibody
      • PP1R10 antibody
      • protein FB19 antibody
      • Protein phosphatase 1 nuclear targeting subunit antibody
      • Protein phosphatase 1 regulatory (inhibitor) subunit 10 antibody
      • Protein phosphatase 1 regulatory subunit 10 antibody
      • R111 antibody
      • Serine/threonine protein phosphatase 1 regulatory subunit 10 antibody
      see all

    Anti-PPP1R10 antibody images

    • ab84377 at 1/250, staining human PPP1R10 in a section of human breast adenocarcinoma by immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).

    References for Anti-PPP1R10 antibody (ab84377)

    ab84377 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab84377.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"