Overview

  • Product nameAnti-PPP1R15B antibody
    See all PPP1R15B primary antibodies
  • Description
    Rabbit polyclonal to PPP1R15B
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 480-529 (

    SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL

    ) of Human PPP1R15B (NP_116222).

  • Positive control
    • THP-1 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab113809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 79 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevancePPP1R15B belongs to the PPP1R15 family. It maintains low levels of EIF2S1 phosphorylation in un-stressed cells by promoting its dephosphorylation by PP1. The phosphatase activity of the PPP1R15B-PP1 complex toward EIF2S1 is specifically inhibited by Salubrinal, a drug that protects cells from endoplasmic reticulum stress.
  • Database links
  • Alternative names
    • CREP antibody
    • FLJ14744 antibody
    • PPP1R15B antibody
    • Protein phosphatase 1, regulatory (inhibitor) subunit 15B antibody
    • Protein phosphatase 1, regulatory subunit 15B antibody
    see all

Anti-PPP1R15B antibody images

  • Anti-PPP1R15B antibody (ab113809) at 1 µg/ml + THP-1 cell lysate at 10 µg

    Predicted band size : 79 kDa

References for Anti-PPP1R15B antibody (ab113809)

ab113809 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"