Overview

  • Product name
  • Description
    Mouse polyclonal to PPP2R2C
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Pig, Xenopus laevis, Zebrafish, Cynomolgus monkey, Orangutan, Xenopus tropicalis
  • Immunogen

    Recombinant full length protein corresponding to Human PPP2R2C aa 1-430. Isoform 3 (AAH32954.1)
    Sequence:

    MGKRDTADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEY DVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKL WKITERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRI FANGHTYHINSISVNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPAN MEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAAALCDKHSKLFEE PEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRDYLTVKVWDLNMEARPIE TYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNNFFRMFDR NTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILH TAWHPAENIIAIAATNNLYIFQDKVNSDMH


    Database link: Q9Y2T4-3

  • Positive control
    • PPP2R2C-transfected 293T cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab172086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa.

Target

  • Function
    The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Sequence similarities
    Belongs to the phosphatase 2A regulatory subunit B family.
    Contains 7 WD repeats.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2ABG_HUMAN antibody
    • B55 gamma antibody
    • Gamma isoform of regulatory subunit B55 protein phosphatase 2 antibody
    • IMYPNO 1 antibody
    • IMYPNO antibody
    • IMYPNO1 antibody
    • MGC33570 antibody
    • OTTHUMP00000115505 antibody
    • Phosphoprotein phosphatase 2A BR gamma regulatory chain antibody
    • PP2A subunit B B gamma isoform antibody
    • PP2A subunit B B55 gamma isoform antibody
    • PP2A subunit B isoform B55-gamma antibody
    • PP2A subunit B isoform gamma antibody
    • PP2A subunit B isoform PR55-gamma antibody
    • PP2A subunit B isoform R2-gamma antibody
    • PP2A subunit B PR55 gamma isoform antibody
    • PP2A subunit B R2 gamma isoform antibody
    • PPP2R2C antibody
    • PPP2R2C protein antibody
    • PR 52 antibody
    • PR 55G antibody
    • PR52 antibody
    • PR55G antibody
    • Protein phosphatase 2 (formerly 2A) regulatory subunit B gamma isoform antibody
    • Protein phosphatase 2 regulatory subunit B gamma antibody
    • Protein phosphatase 2 regulatory subunit B gamma isoform antibody
    • Protein phosphatase 2A1 B gamma subunit antibody
    • Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform antibody
    • Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform antibody
    see all

Images

  • All lanes : Anti-PPP2R2C antibody (ab172086) at 1 µg/ml

    Lane 1 : PPP2R2C-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 49 kDa

References

ab172086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up