Overview

  • Product name
  • Description
    Rabbit Polyclonal to PPP2R4
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human PPP2R4 aa 1-323.
    Sequence:

    MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIG FILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRF GNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRID YGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYR MEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKD YMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECL EKFPVIQHFKFGSLLPIHPVTSG


    Database link: Q15257

  • Positive control
    • MCF7 cell extract.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB 1/500 - 1/2000. Predicted molecular weight: 41 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function
    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for serine/threonine-protein phosphatase 2A (PP2A) modulating its activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a proposed direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2A(i)) in presence of ATP and Mg(2+) (By similarity). Reversibly stimulates the variable phosphotyrosyl phosphatase activity of PP2A core heterodimer PP2A(D) in presence of ATP and Mg(2+) (in vitro). The phosphotyrosyl phosphatase activity is dependent of an ATPase activty of the PP2A(D):PPP2R4 complex. Is involved in apoptosis; the function appears to be independent from PP2A.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the PTPA-type PPIase family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • subunit B'' antibody
    • KIAA0044 antibody
    • MGC2184 antibody
    • Phosphotyrosyl phosphatase activator antibody
    • PP2A antibody
    • PP2A phosphatase activator antibody
    • PP2A subunit B' antibody
    • PP2A subunit B' isoform PR53 antibody
    • PP2A subunit B' PR53 isoform antibody
    • PPP2R4 antibody
    • PR53 antibody
    • PR53 isoform antibody
    • Protein phosphatase 2, regulatory subunit B-prime antibody
    • Protein phosphatase 2A activator regulatory subunit 4 antibody
    • Protein phosphatase 2A regulatory subunit B' (PR 53) antibody
    • PTPA antibody
    • PTPA_HUMAN antibody
    • Serine/threonine protein phosphatase 2A regulatory subunit B' antibody
    • Serine/threonine-protein phosphatase 2A activator antibody
    • Serine/threonine-protein phosphatase 2A regulatory subunit 4 antibody
    • Serine/threonine-protein phosphatase 2A regulatory subunit B'' antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab186866. Blue DAPI for nuclear staining.
  • Anti-PPP2R4 antibody (ab186866) at 1/500 dilution + MCF7 cell extract

    Predicted band size : 41 kDa

References

ab186866 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up