Customer reviews and FAQs

Overview

  • Product nameAnti-PPP2R5E antibody
    See all PPP2R5E primary antibodies
  • Description
    Rabbit polyclonal to PPP2R5E
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 120-169 (

    SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP

    ) of Mouse PPP2R5E (NP_036154).

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control
    • Mouse Spleen Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab113784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionThe B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Sequence similaritiesBelongs to the phosphatase 2A regulatory subunit B56 family.
  • Post-translational
    modifications    Phosphorylated on serine residues.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
    • Alternative names
      • 2A5E_HUMAN antibody
      • Epsilon isoform of regulatory subunit B56 protein phosphatase 2A antibody
      • PP2A B subunit B' epsilon antibody
      • PP2A B subunit B' epsilon isoform antibody
      • PP2A B subunit B56 epsilon antibody
      • PP2A B subunit B56 epsilon isoform antibody
      • PP2A B subunit isoform B''-epsilon antibody
      • PP2A B subunit isoform B'-epsilon antibody
      • PP2A B subunit isoform B56-epsilon antibody
      • PP2A B subunit isoform PR61-epsilon antibody
      • PP2A B subunit isoform R5-epsilon antibody
      • PP2A B subunit PR61 epsilon antibody
      • PP2A B subunit PR61 epsilon isoform antibody
      • PP2A B subunit R5 epsilon antibody
      • PP2A B subunit R5 epsilon isoform antibody
      • PPP2R5E antibody
      • Protein phosphatase 2 regulatory subunit B (B56) epsilon isoform antibody
      • Protein phosphatase 2 regulatory subunit B' epsilon antibody
      • Protein phosphatase 2 regulatory subunit B' epsilon isoform antibody
      • Regulatory subunit B of protein phosphatase 2 epsilon isoform antibody
      • Serine/threonine protein phosphatase 2A 56 kDa regulatory subunit epsilon antibody
      • Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform antibody
      see all

    Anti-PPP2R5E antibody images

    • Western blot - PPP2R5E antibody (ab113784)
      Western blot - PPP2R5E antibody (ab113784)
      Anti-PPP2R5E antibody (ab113784) at 1 µg/ml + Mouse Spleen Lysate at 10 µg

      Predicted band size : 55 kDa

    References for Anti-PPP2R5E antibody (ab113784)

    ab113784 has not yet been referenced specifically in any publications.

    Publishing research using ab113784? Please let us know so that we can cite the reference in this datasheet.

    Product Wall

    Submit an abreview for ab113784 Submit a question for ab113784

    4 Abreviews or Q&A

    10
    Votes: Highest First

    I have been using this antibody in WB and obtaining no signal:

    sample - mouse embryonic fibroblasts; loaded 12, 24 ug to gel
    block - 5% milk
    1' ab - 1:1000, 1:500 o/n at 4oC

    Thank you for contacting Abcam regarding ab113784.


    I am sorry that you have been experiencing difficulties with this antibody in WB. As we discussed over the phone, I think it would be beneficial to also test 5% BSA as a blocking reagen...

    Read More

    I was very happy with the way my complaint was handled and with Abcams' willingness to provide a replacement product, hence did not follow up with it further. The replacement antibody did not work well with my lysates and I was starting to think that i...

    Read More

    Thank you for your reply. I am happy to hear that you have been satisfied with the way I have handled your complaint.

    I am sorry that the replacement antibody did not perform as stated on the datasheet. I have asked our accounting department...

    Read More

    That sounds good I will be glad to try your recommendation. Please send ab1083 to me. Thank you for your help.

    Thank you for your reply.

    I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement.

    To check the status of the order ple...

    Read More

    thank you for your email. I've tried the antibody again with 10, 20 or 30ug of protein loaded from 2 different mouse cell lines, 2hour blocking in 5%BSA followed by incubation at 1:500 in 5%BSA 4oC overnight. The blot was still dirty and major band was...

    Read More

    Thank you for your reply.


    I am sorry to hear that my suggestions did not improve your results with this antibody. I would be happy to offer a replacement product. I would like to recommend ab1083, which is validated for mouse samples in...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"