Overview

  • Product name
  • Description
    Mouse polyclonal to PPP3R2
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Full length protein corresponding to Human PPP3R2 aa 1-173.
    Sequence:

    MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLP ELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFS IYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGK ISFEEFSAVVRDLEIHKKLVLIV


    Database link: NP_671709.1

  • Positive control
    • Lysate from 293T cells transfected with PPP3R2.

Properties

Applications

Our Abpromise guarantee covers the use of ab172099 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Function
    Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
  • Tissue specificity
    Testis-specific.
  • Sequence similarities
    Belongs to the calcineurin regulatory subunit family.
    Contains 4 EF-hand domains.
  • Information by UniProt
  • Database links
  • Alternative names
    • Calcineurin B like protein antibody
    • Calcineurin B type II (19kDa) antibody
    • Calcineurin B type II antibody
    • Calcineurin B-like protein antibody
    • Calcineurin BII antibody
    • Calcineurin subunit B isoform 2 antibody
    • Calcineurin subunit B type 2 antibody
    • CANB2_HUMAN antibody
    • CBLP antibody
    • CBLP like antibody
    • CNBII antibody
    • PPP3R1-like antibody
    • Ppp3r2 antibody
    • PPP3RL antibody
    • Protein phosphatase 2B regulatory subunit 2 antibody
    • Protein phosphatase 3 (formerly 2B) regulatory subunit B (19kD) beta isoform (calcineurin B type II) antibody
    • Protein phosphatase 3 (formerly 2B) regulatory subunit B beta isoform antibody
    • Protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, beta isoform (calcineurin B, type II) antibody
    • Protein phosphatase 3 regulatory subunit B (19kD) beta isoform (calcineurin B type II) antibody
    • Protein phosphatase 3 regulatory subunit B (calcineurin B) like antibody
    • Protein phosphatase 3 regulatory subunit B beta antibody
    • Protein phosphatase 3 regulatory subunit B beta isoform antibody
    see all

Images

  • All lanes : Anti-PPP3R2 antibody (ab172099) at 1 µg/ml

    Lane 1 : Lysate from 293T cells transfected with PPP3R2
    Lane 2 : Lysate from untransfected 293T cells

    Lysates/proteins at 15 µg per lane.

    Predicted band size: 20 kDa

References

ab172099 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172099.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up