Overview

  • Product name
    Anti-PPPDE2 antibody
  • Description
    Rabbit polyclonal to PPPDE2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PPPDE2 aa 27-82.
    Sequence:

    IMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGS TEVTEE


    Database link: Q6ICB0

  • Positive control
    • Human stomach tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab185286 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Protease which deconjugates SUMO1, SUMO2 and SUMO3 from some substrate proteins. Has isopeptidase but not SUMO-processing activity. Desumoylates ZBTB46.
  • Sequence similarities
    Belongs to the DeSI family.
    Contains 1 PPPDE peptidase domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • D15Wsu75e antibody
    • DeSI-1 antibody
    • DESI1 antibody
    • DESI1_HUMAN antibody
    • Desumoylating isopeptidase 1 antibody
    • DJ347H13.4 antibody
    • FAM152B antibody
    • Family with sequence similarity 152 member B antibody
    • MGC138384 antibody
    • PPPDE 2 antibody
    • PPPDE peptidase domain containing 2 antibody
    • PPPDE peptidase domain containing protein 2 antibody
    • PPPDE peptidase domain-containing protein 2 antibody
    • Protein FAM152B antibody
    see all

Images

  • Immunohistochemical analysis of Human stomach tissue labeling PPPDE2 with ab185286 at 1/200 dilution

References

ab185286 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185286.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up