
  • Product nameAnti-PRAMEF10 antibody
    See all PRAMEF10 primary antibodies
  • Description
    Rabbit polyclonal to PRAMEF10
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Cat
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 395-444 (DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREV R) of Human PRAMEF10 (NP_001034450).

  • Positive control
    • Fetal brain lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab84688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-PRAMEF10 antibody images

  • Anti-PRAMEF10 antibody (ab84688) at 1 µg/ml + Fetal brain lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 55 kDa
    Observed band size : 55 kDa
    Additional bands at : 28 kDa. We are unsure as to the identity of these extra bands.

References for Anti-PRAMEF10 antibody (ab84688)

ab84688 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84688.
Please use the links above to contact us or submit feedback about this product.