Overview

  • Product name
    Anti-PRDM7 antibody
  • Description
    Rabbit polyclonal to PRDM7
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PRDM7 aa 2-113. (BC107033).
    Sequence:

    CQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAG LGVWNEASDLPLGLHFGPYEGRITEDEEAANSGYSWLITKGRNCYEYVDG KDKSSANWMRTK


    Database link: Q9NQW5-2

  • Positive control
    • OVACR3 cell lysate; Human fetal testis tissue.

Properties

  • Form
    Lyophilised:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab177033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Detects a band of approximately 56 kDa (predicted molecular weight: 18, 56 kDa).
IHC-P 1/100 - 1/500.

Target

  • Function
    Probable histone methyltransferase.
  • Sequence similarities
    Contains 1 KRAB-related domain.
    Contains 1 SET domain.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt
  • Database links
  • Alternative names
    • PFM4 antibody
    • PR domain containing 7 antibody
    • PR domain family protein 4 antibody
    • PR domain zinc finger protein 7 antibody
    • PR domain-containing protein 7 antibody
    • PRDM7 antibody
    • PRDM7_HUMAN antibody
    • Probable histone-lysine N-methyltransferase PRDM7 antibody
    • ZNF910 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal testis tissue labeling PRDM7 with ab177033 at 1/100 dilution.

  • Anti-PRDM7 antibody (ab177033) at 1/500 dilution + OVACR3 cell lysate

    Predicted band size : 18, 56 kDa
    Observed band size : 56 kDa (why is the actual band size different from the predicted?)

References

ab177033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up