Overview

  • Product nameAnti-Pre4 antibody
  • Description
    Mouse polyclonal to Pre4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Saccharomyces cerevisiae
  • Immunogen

    Fusion protein:

    GVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRV LYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTGKI

    , corresponding to amino acids 166-266 of Saccharomyces cerevisiae Pre4

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab21639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 29 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • RelevanceThe yeast 20S proteasome consists of 7 alpha and 7 beta subunits forming a highly ordered ring structure. Pre4 is one of the beta subunits (also known as beta7). The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Pre3 and Pre4 are necessary for post-acidic peptidase activity and Pre4 is also thought to play a role in mediating generation of the 20S proteasome from its precursors.
  • Cellular localizationCytoplasmic and Nuclear
  • Database links
    • Alternative names
      • Macropain subunit PRE4 antibody
      • Multicatalytic endopeptidase complex subunit PRE4 antibody
      • Proteasome component PRE4 antibody
      • Proteinase YSCE subunit PRE4 antibody
      • YFR050C antibody
      see all

    References for Anti-Pre4 antibody (ab21639)

    ab21639 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab21639.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"