Anti-PREB antibody - N-terminal (ab171064)

Overview

  • Product name
    Anti-PREB antibody - N-terminal
    See all PREB primary antibodies
  • Description
    Rabbit polyclonal to PREB - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Mouse PREB aa 3-52 (N terminal). The exact sequence is proprietary.
    Sequence:

    RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL


    Database link: Q9WUQ2

  • Positive control
    • Mouse liver lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab171064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa.

Target

  • Function
    Was first identified based on its probable role in the regulation of pituitary gene transcription. Binds to the prolactin gene (PRL) promoter and seems to activate transcription (By similarity). Guanine nucleotide exchange factor that activates SARA2. Required for the formation of COPII transport vesicles from the ER.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 3 WD repeats.
  • Cellular localization
    Nucleus. Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Mammalian guanine nucleotide exchange factor mSec12 antibody
    • Preb antibody
    • PREB_HUMAN antibody
    • Prolactin regulatory binding element protein antibody
    • Prolactin regulatory element binding antibody
    • Prolactin regulatory element binding protein antibody
    • Prolactin regulatory element-binding protein antibody
    • SEC12 antibody
    see all

Images

  • Anti-PREB antibody - N-terminal (ab171064) at 1 µg/ml + Mouse liver lysate at 10 µg

    Predicted band size: 45 kDa

References

ab171064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (Mice hepatocytes)
Gel Running Conditions
Reduced Denaturing (8% SDS-PAGE)
Loading amount
25 µg
Specification
Mice hepatocytes
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C
Username

Dr. Armen Petrosyan

Verified customer

Submitted May 31 2018

Application
Western blot
Sample
Rat Cell lysate - whole cell (Rat hepatocytes)
Gel Running Conditions
Reduced Denaturing (10% SDS-PAGE)
Loading amount
15 µg
Specification
Rat hepatocytes
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C
Username

Dr. Armen Petrosyan

Verified customer

Submitted Feb 20 2017

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Rat Cell (Rat hepatocytes)
Permeabilization
Yes - 0.2% Triton X-100 in PBS
Specification
Rat hepatocytes
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 22°C
Fixative
Formaldehyde
Username

Dr. Armen Petrosyan

Verified customer

Submitted Dec 21 2016

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HepG2 cells)
Permeabilization
Yes - 0.2% Triton X-100 in PBS
Specification
HepG2 cells
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 22°C
Fixative
Formaldehyde
Username

Dr. Armen Petrosyan

Verified customer

Submitted Dec 21 2016

Application
Western blot
Loading amount
50 µg
Gel Running Conditions
Reduced Denaturing (4-20%)
Sample
Human Cell lysate - whole cell (hEK293)
Specification
hEK293
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C
Username

Abcam user community

Verified customer

Submitted Mar 16 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up