Overview

  • Product nameAnti-PRIM1 antibody
    See all PRIM1 primary antibodies
  • Description
    Rabbit polyclonal to PRIM1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 363-442 (

    EKEKEENEADSKHRVRGYKKTSLAPYVKVFEQFLENLDKSRKGELLKKSD

    ) of human PRIM1 (NP_032947).

  • Positive control
    • Mouse kidney lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 98% PBS, 0.2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab113804 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionDNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.
  • Sequence similaritiesBelongs to the eukaryotic-type primase small subunit family.
  • Information by UniProt
  • Database links
  • Alternative names
    • AI324982 antibody
    • DNA primase 49 kDa subunit antibody
    • DNA primase small subunit antibody
    • MGC107288 antibody
    • MGC109113 antibody
    • p49 antibody
    • PRI1_HUMAN antibody
    • PRIM1 antibody
    see all

Anti-PRIM1 antibody images

  • Anti-PRIM1 antibody (ab113804) at 1 µg/ml + Mouse kidney lysate at 10 µg

    Predicted band size : 50 kDa

References for Anti-PRIM1 antibody (ab113804)

ab113804 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113804.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"