Overview

  • Product nameAnti-PRKX antibody
    See all PRKX primary antibodies
  • Description
    Rabbit polyclonal to PRKX
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1-50,

    MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD

    , of Human PRKX (NP_005035)

  • Positive control
    • HepG2 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab98196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 41 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Tissue specificityHigh levels in adult and fetal brain, kidney and lung; low levels in adult placenta, heart, liver, skeletal muscle, pancreas and fetal liver.
  • Involvement in diseaseNote=A chromosomal aberration involving PRKX is a cause of sex reversal disorder. Translocation t(X;Y)(p22;p11) with PRKY. Chromosomal translocations proximal to PRKY account for about 30% of the cases of sex reversal disorder in XX males and XY females.
  • Sequence similaritiesBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • PKX1 antibody
    • PRKX antibody
    • PRKX_HUMAN antibody
    • Protein kinase PKX1 antibody
    • Serine/threonine-protein kinase PRKX antibody
    see all

Anti-PRKX antibody images

  • Anti-PRKX antibody (ab98196) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 41 kDa

References for Anti-PRKX antibody (ab98196)

ab98196 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"