Overview

  • Product name
  • Description
    Rabbit polyclonal to PRMT3
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1 - 50 (

    MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPC

    ) of Human PRMT3 (NP_005779.1).

  • Positive control
    • HeLa or 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab91430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
IP
  • Application notes
    IP: Use at 5 - 15µg/mg of lysate.
    WB: 1/2000 - 1/10000. Predicted molecular weight: 60 kDa.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • Function
      Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.
    • Sequence similarities
      Belongs to the protein arginine N-methyltransferase family.
      Contains 1 C2H2-type zinc finger.
    • Domain
      The zinc-finger is responsible for substrate specificity.
    • Cellular localization
      Cytoplasm.
    • Information by UniProt
    • Database links
    • Alternative names
      • 2010005E20Rik antibody
      • 2410018A17Rik antibody
      • AL033309 antibody
      • ANM3_HUMAN antibody
      • Heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 3 antibody
      • Heterogeneous nuclear ribonucleoprotein methyltransferase like 3 antibody
      • Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 3 antibody
      • Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3 antibody
      • HMT1 hnRNP methyltransferase like 3 antibody
      • HMT1 hnRNP methyltransferase like 3 S. cerevisiae antibody
      • HMT1-like 3 antibody
      • hnRNP methyltransferase like 3 antibody
      • HRMT1L3 antibody
      • PRMT 3 antibody
      • PRMT3 antibody
      • Protein arginine methyltransferase 3 antibody
      • Protein arginine N methyltransferase 3 antibody
      • Protein arginine N-methyltransferase 3 antibody
      see all

    Images

    • All lanes : Anti-PRMT3 antibody (ab91430) at 0.1 µg/ml

      Lane 1 : HeLa cell lysate at 50 µg
      Lane 2 : HeLa cell lysate at 15 µg
      Lane 3 : HeLa cell lysate at 5 µg
      Lane 4 : 293T cell lysate at 50 µg

      Developed using the ECL technique

      Predicted band size : 60 kDa


      Exposure time : 30 seconds
    • SSA1 was immunoprecipitated from 1mg HeLa whole cell lysate using 10µg ab91430.
      20% of the immunoprecipitate was loaded per lane, and probed with ab91430 at 1µg/ml (lane 1) or a control IgG (lane2).
      Detection: chemoluminescence with an exposure time of 30 seconds.

    References

    This product has been referenced in:
    • Mizuno K & Sloboda RD Protein arginine methyltransferases interact with intraflagellar transport particles and change location during flagellar growth and resorption. Mol Biol Cell 28:1208-1222 (2017). Read more (PubMed: 28298486) »

    See 1 Publication for this product

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab91430.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up