Overview

  • Product name
    Anti-PRMT3 antibody (Biotin)
    See all PRMT3 primary antibodies
  • Description
    Mouse monoclonal to PRMT3 (Biotin)
  • Conjugation
    Biotin
  • Specificity
    ab200939 was developed against a fully folded protein domain, so it does not show good reactivity against denatured proteins, and may not work in western blot applications.
  • Tested applications
    Suitable for: IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PRMT3 aa 211-531.
    Sequence:

    DLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVL DVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIK GKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYP DICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPK TLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFE KNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKSKK DPRSLTVTLTLNNSTQTYGLQ


    Database link: O60678

  • Positive control
    • HEK293 cells.
  • General notes

    This product consists of purified Fab fragments which do not have an Fc domain that can be used for detection by secondary reagents. To enable simple and robust detection, the Fab fragments are specifically biotinylated on the C-terminus of the heavy chain. The extremely strong and specific interaction between biotin and streptavidin enables any streptavidin conjugated secondary reagent to be used for detection.

Properties

Applications

Our Abpromise guarantee covers the use of ab200939 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.

2 µg per IP.

Target

  • Function
    Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.
  • Sequence similarities
    Belongs to the protein arginine N-methyltransferase family.
    Contains 1 C2H2-type zinc finger.
  • Domain
    The zinc-finger is responsible for substrate specificity.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2010005E20Rik antibody
    • 2410018A17Rik antibody
    • AL033309 antibody
    • ANM3_HUMAN antibody
    • Heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 3 antibody
    • Heterogeneous nuclear ribonucleoprotein methyltransferase like 3 antibody
    • Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 3 antibody
    • Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3 antibody
    • HMT1 hnRNP methyltransferase like 3 antibody
    • HMT1 hnRNP methyltransferase like 3 S. cerevisiae antibody
    • HMT1-like 3 antibody
    • hnRNP methyltransferase like 3 antibody
    • HRMT1L3 antibody
    • PRMT 3 antibody
    • PRMT3 antibody
    • Protein arginine methyltransferase 3 antibody
    • Protein arginine N methyltransferase 3 antibody
    • Protein arginine N-methyltransferase 3 antibody
    see all

References

ab200939 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200939.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up