Overview

  • Product name
  • Description
    Mouse polyclonal to PRMT5
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Full length protein corresponding to Human PRMT5 aa 1-637.
    Sequence:

    MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRF KREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIR RNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSM FWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSK RIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMH QRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELF AKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVP EEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVT LENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECL DGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEM PYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHG FAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICV RFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL


    Database link: NP_006100.2

  • Positive control
    • PRMT5 transfected 293T cell line lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 73 kDa.

Target

  • Function
    Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3); such methylation being required for the assembly and biogenesis of snRNP core particles. Methylates SUPT5H. Mono- and dimethylates arginine residues of myelin basic protein (MBP) in vitro. Plays a role in the assembly of snRNP core particles. May play a role in cytokine-activated transduction pathways. Negatively regulates cyclin E1 promoter activity and cellular proliferation. May regulate the SUPT5H transcriptional elongation properties. May be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. Methylates histone H2A and H4 'Arg-3' during germ cell development. Methylates histone H3 'Arg-8', which may repress transcription. Methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage. Methylates RPS10.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the protein arginine N-methyltransferase family.
  • Post-translational
    modifications
    Disulfide bonds and non-covalent association mediate homooligomers formation.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 72 kDa ICln binding protein antibody
    • 72 kDa ICln-binding protein antibody
    • ANM5_HUMAN antibody
    • Histone synthetic lethal 7, S. cerevisiae, homolog of antibody
    • Histone-arginine N-methyltransferase PRMT5 antibody
    • HMT1 hnRNP methyltransferase like 5 antibody
    • HOMOLOG OF; SKB1 antibody
    • HRMT1L5 antibody
    • IBP72 antibody
    • Jak-binding protein 1 antibody
    • JBP 1 antibody
    • JBP1 antibody
    • PRMT 5 antibody
    • PRMT5 antibody
    • Protein arginine methyltransferase 5 antibody
    • Protein arginine N methyltransferase 5 antibody
    • Protein arginine N methyltransferase 5 N terminally processed antibody
    • Protein arginine N-methyltransferase 5 antibody
    • S. POMBE antibody
    • S. POMBE HOMOLOG OF; SKB1 antibody
    • SHK1 KINASE BINDING PROTEIN 1 antibody
    • Shk1 kinase binding protein 1 homolog antibody
    • Shk1 kinase-binding protein 1 homolog antibody
    • Shk1 kinase/binding protein 1, S. pombe, homolog of antibody
    • SKB 1 antibody
    • SKB1 antibody
    • SKB1 homolog antibody
    • SKB1: SKB1 homolog (S. pombe) antibody
    • SKB1Hs antibody
    see all

Images

  • All lanes : Anti-PRMT5 antibody (ab172390) at 1 µg/ml

    Lane 1 : PRMT5 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution

    Predicted band size: 73 kDa

References

ab172390 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up