Anti-PNKD antibody (ab140115)
Key features and details
- Rabbit polyclonal to PNKD
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PNKD antibody -
Description
Rabbit polyclonal to PNKD -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human PNKD aa 164-342.
Sequence:TLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCHQDV VSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRT FEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGFAGVVEPENLARER KMQWVQRQRLERKGTCPSTLGEERSYNPF
-
Positive control
- Human uterine cancer tissue and Human fetal liver lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute in 200 µl sterile H2O -
Storage instructions
Shipped at 4°C. Store at -20ºC. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab140115 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/1000. Predicted molecular weight: 43 kDa.
|
|
IHC-P |
1/100 - 1/500.
|
Notes |
---|
WB
1/500 - 1/1000. Predicted molecular weight: 43 kDa. |
IHC-P
1/100 - 1/500. |
Target
-
Function
Probable hydrolase that plays an aggravative role in the development of cardiac hypertrophy via activation of the NF-kappa-B signaling pathway. -
Tissue specificity
Isoform 1 is only expressed in the brain. Isoform 2 is ubiquitously detected with highest expression in skeletal muscle and detected in myocardial myofibrils. Variant Val-7 and Val-9 are detected in the brain only. -
Involvement in disease
Defects in PNKD are the cause of dystonia type 8 (DYT8) [MIM:118800]. DYT8 is a paroxysmal non-kinesigenic dystonia/dyskinesia. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT8 is characterized by attacks of involuntary movements brought on by stress, alcohol, fatigue or caffeine. The attacks generally last between a few seconds and four hours or longer. The attacks may begin in one limb and spread throughout the body, including the face. -
Sequence similarities
Belongs to the metallo-beta-lactamase superfamily. Glyoxalase II family. -
Post-translational
modificationsIsoform 2 is phosphorylated at Ser-121 upon DNA damage, probably by ATM or ATR. -
Cellular localization
Cytoplasm. Nucleus; Mitochondrion and Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 25953 Human
- Entrez Gene: 56695 Mouse
- Entrez Gene: 100188944 Rat
- Omim: 609023 Human
- SwissProt: Q8N490 Human
- SwissProt: Q69ZP3 Mouse
- Unigene: 98475 Human
- Unigene: 384726 Mouse
-
Alternative names
- 2210013N15Rik antibody
- 2810403H05Rik antibody
- AI854243 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab140115 has not yet been referenced specifically in any publications.