Anti-Proline-rich membrane anchor 1 antibody - C-terminal (ab190277)

Overview

  • Product name
    Anti-Proline-rich membrane anchor 1 antibody - C-terminal
    See all Proline-rich membrane anchor 1 primary antibodies
  • Description
    Rabbit polyclonal to Proline-rich membrane anchor 1 - C-terminal
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Proline-rich membrane anchor 1 aa 119-153 (C terminal).
    Sequence:

    KRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV


    Database link: Q86XR5

  • Positive control
    • Human urinary bladder

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human urinary bladder tissue labeling Proline-rich membrane anchor 1 with ab190277 at 1/50.

  • Immunohistochemical analysis of paraffin-embedded Human urinary tissue labeling Proline-rich membrane anchor 1 with ab190277 at 1/50.

References

ab190277 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up