Overview

  • Product name
    Anti-PROP1 antibody
  • Description
    Rabbit polyclonal to PROP1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Baboon, Gorilla
  • Immunogen

    Recombinant full length protein corresponding to Human PROP1 aa 1-226.
    Sequence:

    MEAERRRQAEKPKKGRVGSSLLPERHPATGTPTTTVDSSAPPCRRLPGAG GGRSRFSPQGGQRGRPHSRRRHRTTFSPVQLEQLESAFGRNQYPDIWARE SLARDTGLSEARIQVWFQNRRAKQRKQERSLLQPLAHLSPAAFSSFLPES TACPYSYAAPPPPVTCFPHPYSHALPSQPSTGGAFALSHQSEDWYPTLHP APAGHLPCPPPPPMLPLSLEPSKSWN


    Database link: NP_006252.1

  • Positive control
    • PROP1-transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172084 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa.

Target

  • Relevance
    PROP1 belongs to the paired homeobox family. It contains one homeobox DNA-binding domain. PROP1 is possibly involved in the ontogenesis of pituitary gonadotropes, as well as somatotropes, lactotropes and caudomedial thyrotropes. It is expressed specifically in embryonic pituitary. Defects in PROP1 are a cause of combined pituitary hormone deficiency (CPHD). This is characterized by impaired production of growth hormone (GH) and one or more of the other five anterior pituitary hormones.
  • Cellular localization
    Nucleus
  • Database links
  • Alternative names
    • CPHD2 antibody
    • Homeobox protein prophet of Pit 1 antibody
    • OTTHUMP00000161487 antibody
    • paired-like homeodomain transcription factor antibody
    • Pituitary specific homeodomain factor antibody
    • PROP 1 antibody
    • PROP paired like homeobox 1 antibody
    • prophet of Pit1 antibody
    see all

Images

  • All lanes : Anti-PROP1 antibody (ab172084) at 1 µg/ml

    Lane 1 : PROP1-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L) at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 25 kDa

References

ab172084 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172084.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up