Anti-Prostatic Acid Phosphatase antibody (ab98037)

Overview

  • Product nameAnti-Prostatic Acid Phosphatase antibody
    See all Prostatic Acid Phosphatase primary antibodies
  • Description
    Rabbit polyclonal to Prostatic Acid Phosphatase
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 215-264 (

    CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV

    ) of Human Prostatic Acid Phosphatase (NP_001090).

  • Positive control
    • NCI-H226 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab98037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Prostatic Acid Phosphatase antibody images

  • Anti-Prostatic Acid Phosphatase antibody (ab98037) at 1 µg/ml (in 5% skim milk / PBS buffer) + NCI-H226 Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 45 kDa

References for Anti-Prostatic Acid Phosphatase antibody (ab98037)

ab98037 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"