Anti-Proteasome 20S alpha 5 antibody (ab94621)

Overview

  • Product nameAnti-Proteasome 20S alpha 5 antibody
    See all Proteasome 20S alpha 5 primary antibodies
  • Description
    Rabbit polyclonal to Proteasome 20S alpha 5
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human Proteasome 20S alpha 5 aa 144-193 (internal sequence).
    Sequence:

    GGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKE


    Database link: P28066

  • Positive control
    • Jurkat cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab94621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Proteasome 20S alpha 5 antibody images

  • Anti-Proteasome 20S alpha 5 antibody (ab94621) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 26 kDa

References for Anti-Proteasome 20S alpha 5 antibody (ab94621)

ab94621 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"