Anti-Proteasome 20S beta 6 antibody (ab94622)

Overview

  • Product nameAnti-Proteasome 20S beta 6 antibody
    See all Proteasome 20S beta 6 primary antibodies
  • Description
    Rabbit polyclonal to Proteasome 20S beta 6
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human Proteasome 20S beta 6 aa 36-85 (N terminal).
    Sequence:

    TIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAAD


    Database link: P28072

  • Positive control
    • Jurkat cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: 0% None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab94622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the peptidyl glutamyl-like activity. May catalyze basal processing of intracellular antigens.
  • Sequence similaritiesBelongs to the peptidase T1B family.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DELTA antibody
    • LMPY antibody
    • Macropain delta chain antibody
    • MGC5169 antibody
    • Multicatalytic endopeptidase complex delta chain antibody
    • Proteasome (prosome macropain) subunit beta type 6 antibody
    • Proteasome beta 6 subunit antibody
    • Proteasome catalytic subunit 1 antibody
    • Proteasome delta chain antibody
    • Proteasome subunit beta 6 antibody
    • Proteasome subunit beta type 6 antibody
    • Proteasome subunit beta type-6 antibody
    • Proteasome subunit delta antibody
    • Proteasome subunit Y antibody
    • PSB6_HUMAN antibody
    • PSMB6 antibody
    • PSY large multifunctional protease Y antibody
    • Y antibody
    see all

Anti-Proteasome 20S beta 6 antibody images

  • Anti-Proteasome 20S beta 6 antibody (ab94622) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 25 kDa

References for Anti-Proteasome 20S beta 6 antibody (ab94622)

ab94622 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"