Anti-Proteasome Inhibitor subunit 1 PI3 1 antibody (ab187200)

Overview

  • Product name
    Anti-Proteasome Inhibitor subunit 1 PI3 1 antibody
    See all Proteasome Inhibitor subunit 1 PI3 1 primary antibodies
  • Description
    Rabbit polyclonal to Proteasome Inhibitor subunit 1 PI3 1
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Proteasome Inhibitor subunit 1 PI3 1 aa 1-271.
    Sequence:

    MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKK SELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQ VADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKAN VSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDP FGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIG TSPPGPNPDHLPPPGYDDMYL


    Database link: Q92530

  • Positive control
    • SW480, A549 and K562 cell extracts; Mouse liver and testis tissue extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab187200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 30 kDa.
IHC-P 1/50 - 1/200.

Target

Images

  • ab18720 Immunohistochemistry of paraffin-embedded human liver injury using PSMF1 antibody at dilution of 1:100 (x40 lens).

  • All lanes : Anti-Proteasome Inhibitor subunit 1 PI3 1 antibody (ab187200) at 1/500 dilution

    Lane 1 : SW480 cell extract
    Lane 2 : A549 cell extract
    Lane 3 : K562 cell extract
    Lane 4 : Mouse liver tissue extract
    Lane 5 : Mouse testis tissue extract


    Predicted band size : 30 kDa

References

ab187200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (Primary MEFs)
Gel Running Conditions
Reduced Denaturing (4-20)
Loading amount
15 µg
Specification
Primary MEFs
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Apr 11 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up