Anti-Proteasome subunit beta type 2 antibody (ab86363)

Overview

  • Product name
    Anti-Proteasome subunit beta type 2 antibody
    See all Proteasome subunit beta type 2 primary antibodies
  • Description
    Rabbit polyclonal to Proteasome subunit beta type 2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human Proteasome subunit beta type 2 aa 108-157 (internal sequence).
    Sequence:

    DEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAV


    Database link: P49721

  • Positive control
    • HepG2 cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    Purified by peptide affinity chromatography method.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab86363 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a trypsin-like activity.
  • Sequence similarities
    Belongs to the peptidase T1B family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • HC7 I antibody
    • Macropain subunit C7 I antibody
    • Macropain subunit C7-I antibody
    • Multicatalytic endopeptidase complex subunit C7 1 antibody
    • Multicatalytic endopeptidase complex subunit C7 I antibody
    • Multicatalytic endopeptidase complex subunit C7-I antibody
    • Proteasome (prosome, macropain) subunit beta type 2 antibody
    • Proteasome beta 2 subunit antibody
    • Proteasome component C7 I antibody
    • Proteasome component C7-I antibody
    • Proteasome subunit beta type-2 antibody
    • PSB2_HUMAN antibody
    • Psmb2 antibody
    see all

Images

  • Anti-Proteasome subunit beta type 2 antibody (ab86363) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 23 kDa
    Observed band size : 23 kDa
    Additional bands at : 38 kDa. We are unsure as to the identity of these extra bands.

References

ab86363 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86363.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up