Anti-Proteasome subunit beta type 2 antibody (ab90510)

Overview

  • Product nameAnti-Proteasome subunit beta type 2 antibody
    See all Proteasome subunit beta type 2 primary antibodies
  • Description
    Rabbit polyclonal to Proteasome subunit beta type 2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human Proteasome subunit beta type 2 aa 144-193.
    Sequence:

    DRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDN


    Database link: P49721

  • Positive control
    • HeLa cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Purification notesab90510 is purified by a peptide affinity chromatography method.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90510 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a trypsin-like activity.
  • Sequence similaritiesBelongs to the peptidase T1B family.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • HC7 I antibody
    • Macropain subunit C7 I antibody
    • Macropain subunit C7-I antibody
    • Multicatalytic endopeptidase complex subunit C7 1 antibody
    • Multicatalytic endopeptidase complex subunit C7 I antibody
    • Multicatalytic endopeptidase complex subunit C7-I antibody
    • Proteasome (prosome, macropain) subunit beta type 2 antibody
    • Proteasome beta 2 subunit antibody
    • Proteasome component C7 I antibody
    • Proteasome component C7-I antibody
    • Proteasome subunit beta type-2 antibody
    • PSB2_HUMAN antibody
    • Psmb2 antibody
    see all

Anti-Proteasome subunit beta type 2 antibody images

  • Anti-Proteasome subunit beta type 2 antibody (ab90510) at 1 µg/ml + HeLa cell lysate at 10 µg

    Secondary
    anti-Rabbit IgG HRP at 1/50000 dilution

    Predicted band size : 23 kDa

References for Anti-Proteasome subunit beta type 2 antibody (ab90510)

ab90510 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90510.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"