Anti-Protein FAM195A antibody - C-terminal (ab190280)

Overview

  • Product name
    Anti-Protein FAM195A antibody - C-terminal
  • Description
    Rabbit polyclonal to Protein FAM195A - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Protein FAM195A aa 95-159 (C terminal).
    Sequence:

    EESVRFVSEAWQQVQQQLDGGPAGEGGPRPVQYVERTPNPRLQNFVPIDL DEWWAQQFLARITSC


    Database link: Q9BUT9

  • Positive control
    • Human heart muscle and liver cancer tissues; Human plasma (IgG/HSA depleted).

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190280 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 18 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • All lanes : Anti-Protein FAM195A antibody - C-terminal (ab190280) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251MG sp cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)

    Predicted band size: 18 kDa

  • Immunohistochemical analysis of paraffin-embedded Human heart muscle tissue labeling Protein FAM195A with ab190280 at 1/1000 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human heart muscle tissue labeling Protein FAM195A with ab190280 at 1/1000 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling Protein FAM195A with ab190280 at 1/1000 dilution.

References

ab190280 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190280.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up