Anti-Protein phosphatase 1 inhibitor subunit 2 antibody (ab116047)

Overview

  • Product nameAnti-Protein phosphatase 1 inhibitor subunit 2 antibody
    See all Protein phosphatase 1 inhibitor subunit 2 primary antibodies
  • Description
    Rabbit polyclonal to Protein phosphatase 1 inhibitor subunit 2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 27-76 (

    ASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYH

    ) of Human Protein phosphatase 1 inhibitor subunit 2 (NP_006232).

  • Positive control
    • THP-1 cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 2% Sucrose, 97% PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab116047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Protein phosphatase 1 inhibitor subunit 2 antibody images

  • Anti-Protein phosphatase 1 inhibitor subunit 2 antibody (ab116047) at 1 µg/ml + THP-1 cell lysate at 10 µg

    Predicted band size : 23 kDa

References for Anti-Protein phosphatase 1 inhibitor subunit 2 antibody (ab116047)

ab116047 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"