Anti-Protein phosphatase inhibitor 1 antibody (ab125320)

Overview

  • Product nameAnti-Protein phosphatase inhibitor 1 antibody
    See all Protein phosphatase inhibitor 1 primary antibodies
  • Description
    Rabbit polyclonal to Protein phosphatase inhibitor 1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Chicken, Guinea pig, Cow, Dog, Human
  • Immunogen

    Synthetic peptide within Mouse Protein phosphatase inhibitor 1 aa 12-61 (N terminal). The exact sequence is proprietary.
    Sequence:

    FTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNSLLK


    Database link: NP_067366

  • Positive control
    • Mouse pancreas lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab125320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 19 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Protein phosphatase inhibitor 1 antibody images

  • Anti-Protein phosphatase inhibitor 1 antibody (ab125320) at 1 µg/ml + Mouse pancreas lysate at 10 µg

    Predicted band size : 19 kDa
    Gel concentration: 10-20%

References for Anti-Protein phosphatase inhibitor 1 antibody (ab125320)

ab125320 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"