Anti-Protein phosphatase inhibitor 1 antibody (ab125320)

Overview

  • Product name
    Anti-Protein phosphatase inhibitor 1 antibody
    See all Protein phosphatase inhibitor 1 primary antibodies
  • Description
    Rabbit polyclonal to Protein phosphatase inhibitor 1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Chicken, Guinea pig, Cow, Dog, Human
  • Immunogen

    Synthetic peptide within Mouse Protein phosphatase inhibitor 1 aa 12-61 (N terminal). The exact sequence is proprietary.
    Sequence:

    FTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNSLLK


    Database link: NP_067366

  • Positive control
    • Mouse pancreas lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab125320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 19 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-Protein phosphatase inhibitor 1 antibody (ab125320) at 1 µg/ml + Mouse pancreas lysate at 10 µg

    Predicted band size : 19 kDa
    Gel concentration: 10-20%

References

ab125320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab125320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up