Overview

  • Product name
    Anti-Protein ViaA antibody
    See all Protein ViaA primary antibodies
  • Description
    Rabbit polyclonal to Protein ViaA
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Salmonella typhi
  • Immunogen

    Recombinant fragment corresponding to Protein ViaA aa 3-476. From Salmonella typhi.
    Sequence:

    TLDTLNTMLAVSEEGMVEEMILALLASPQLVIFFEKFPRLKNAVTADLPR WREALRSRLKDARVPPELTEEVMCYQQSQLLSTPQFIVQLPQILALLHRL HSPYAAQAKQLTESNSTFTPALHTLFLQRWRLSLVVQATTLNQQLLEEER EQLLSDVQERMTLSGQLEPTLAENDNAAGRLWDMSAGQLKRGDYQLIVKY GEFLAAQPELMQLAEQLGRSREAKSVPKKDAPMETFRTLVREPATVPEQV DGIQQGDDILRLLPPELATLGITELEYEFYRRLVEKQLLTYRLHGEAWRE KVTERPVVHQDVDEQPRGPFIVCVDTSGSMGGFNEQCAKAFCLALMRVAL ADNRRCFIMLFSTDVVRYELSGPESIEQAIRFLSQRFRGGTDIASCFRAI IERMQGREWFDADAVVISDFIAQRLPDDVVSKVGELQRLHQHRFHAVAMS AHGKPGIMRIFDHIWRFDTGMRSR


    Database link: Q8Z2R0

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/2000. Predicted molecular weight: 55 kDa.

Target

  • Database links
    • Alternative names
      • Protein ViaA antibody
      • viaA antibody
      • VWA domain protein interacting with AAA ATPase antibody

    References

    ab193622 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193622.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up