Overview

  • Product name
  • Description
    Rabbit polyclonal to Protor-1
  • Tested applications
    Suitable for: IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Cow, Dog, Turkey, Pig, Chimpanzee, Rhesus monkey, Chinese hamster
  • Immunogen

    Synthetic peptide within Human Protor-1 aa 225-275. The exact sequence is proprietary. (NP_851850.1).
    Sequence:

    THSCILEKRLLRRSRSGDVLAKNPVVRSKSYNTPLLNPVQEHEAEGAAAG G


    Database link: P85299

  • Positive control
    • 293T whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab186018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    Subunit of mTORC2, which regulates cell growth and survival in response to hormonal signals. mTORC2 is activated by growth factors, but, in contrast to mTORC1, seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 plays a critical role in AKT1 'Ser-473' phosphorylation, which may facilitate the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDK1 which is a prerequisite for full activation. mTORC2 regulates the phosphorylation of SGK1 at 'Ser-422'. mTORC2 also modulates the phosphorylation of PRKCA on 'Ser-657'. PRR5 plays an important role in regulation of PDGFRB expression and in modulation of platelet-derived growth factor signaling. May act as a tumor suppressor in breast cancer.
  • Tissue specificity
    Most abundant in kidney and liver. Also highly expressed in brain, spleen, testis and placenta. Overexpressed in several colorectal tumors.
  • Sequence similarities
    Belongs to the PROTOR family.
  • Information by UniProt
  • Database links
  • Alternative names
    • Arhgap8 antibody
    • AU043908 antibody
    • C030017C09Rik antibody
    • C78947 antibody
    • FLJ20185 antibody
    • FLJ20185k antibody
    • MGC109513 antibody
    • MGC32512 antibody
    • PP610 antibody
    • Proline rich 5 (renal) antibody
    • Proline-rich protein 5 antibody
    • Protein observed with Rictor-1 antibody
    • Protor-1 antibody
    • PROTOR1 antibody
    • PRR5 antibody
    • PRR5_HUMAN antibody
    • PTOR1 antibody
    • Rho GTPase activating protein 8 antibody
    • RP1-181C9.3 antibody
    see all

Images

  • Detection of Proctor-1 in immunoprecipitates of 293T whole cell lysate (1 mg for IP, 20% of IP loaded) using ab186018 at 6 µg/mg lysate for IP. An alternative Rabbit anti-Proctor-1 antibody was used at 1 µg/ml for subsequent western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab186018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up