Anti-PSMA antibody [GCP05] (Alexa Fluor® 488) (ab187570)

Overview

  • Product name
    Anti-PSMA antibody [GCP05] (Alexa Fluor® 488)
    See all PSMA primary antibodies
  • Description
    Mouse monoclonal [GCP05] to PSMA (Alexa Fluor® 488)
  • Host species
    Mouse
  • Conjugation
    Alexa Fluor® 488. Ex: 495nm, Em: 519nm
  • Tested applications
    Suitable for: Flow Cytmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig
  • Immunogen

    Recombinant fragment corresponding to Human PSMA aa 44-750. Extracellular domain
    Sequence:

    KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLA KQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSL FEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMK INCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYP DGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIP VHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVK MHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAA VVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQ ERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSL YESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWET NKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVL PFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIA SKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYA PSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAA ETLSEVA


    Database link: Q04609

  • Positive control
    • LNCaP cell line.

Properties

Applications

Our Abpromise guarantee covers the use of ab187570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use a concentration of 6 µg/ml.

ab171463 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function
    Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Isoform PSM-4 and isoform PSM-5 would appear to be physiologically irrelevant. Involved in prostate tumor progression.
    Also exhibits a dipeptidyl-peptidase IV type activity. In vitro, cleaves Gly-Pro-AMC.
  • Tissue specificity
    Highly expressed in prostate epithelium. Detected in urinary bladder, kidney, testis, ovary, fallopian tube, breast, adrenal gland, liver, esophagus, stomach, small intestine, colon and brain (at protein level). Detected in the small intestine, brain, kidney, liver, spleen, colon, trachea, spinal cord and the capillary endothelium of a variety of tumors. Expressed specifically in jejunum brush border membranes. In the brain, highly expressed in the ventral striatum and brain stem. Also expressed in fetal liver and kidney. Isoform PSMA' is the most abundant form in normal prostate. Isoform PSMA-1 is the most abundant form in primary prostate tumors. Isoform PSMA-2 is also found in normal prostate as well as in brain and liver. Isoform PSMA-9 is specifically expressed in prostate cancer.
  • Sequence similarities
    Belongs to the peptidase M28 family. M28B subfamily.
  • Domain
    The NAALADase activity is found in the central region, the dipeptidyl peptidase IV type activity in the C-terminal.
  • Post-translational
    modifications
    The first two amino acids at the N-terminus of isoform PSMA' appear to be cleaved by limited proteolysis.
    The N-terminus is blocked.
  • Cellular localization
    Cytoplasm and Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cell growth inhibiting protein 27 antibody
    • Cell growth-inhibiting gene 27 protein antibody
    • FGCP antibody
    • Folate hydrolase (prostate-specific membrane antigen) 1 antibody
    • Folate hydrolase 1 antibody
    • Folate hydrolase antibody
    • Folate hydrolase prostate specific membrane antigen 1 antibody
    • FOLH 1 antibody
    • FOLH antibody
    • Folh1 antibody
    • FOLH1_HUMAN antibody
    • Folylpoly gamma glutamate carboxypeptidase antibody
    • Folylpoly-gamma-glutamate carboxypeptidase antibody
    • GCP 2 antibody
    • GCP II antibody
    • GCP2 antibody
    • GCPII antibody
    • GIG27 antibody
    • Glutamate carboxylase II antibody
    • Glutamate carboxypeptidase 2 antibody
    • Glutamate carboxypeptidase II antibody
    • Membrane glutamate carboxypeptidase antibody
    • mGCP antibody
    • N acetylated alpha linked acidic dipeptidase 1 antibody
    • N-acetylated-alpha-linked acidic dipeptidase I antibody
    • NAALAD 1 antibody
    • NAALAD1 antibody
    • NAALAdase antibody
    • NAALADase I antibody
    • Prostate specific membrane antigen antibody
    • Prostate specific membrane antigen variant F antibody
    • Prostate-specific membrane antigen antibody
    • PSM antibody
    • PSMA antibody
    • Pteroylpoly gamma glutamate carboxypeptidase antibody
    • Pteroylpoly-gamma-glutamate carboxypeptidase antibody
    see all

References

ab187570 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (LNCaP cell line)
Permeabilization
No
Specification
LNCaP cell line
Fixative
Formaldehyde
Username

Abcam user community

Verified customer

Submitted Mar 31 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up