Overview

  • Product nameAnti-PSMA8 antibody
    See all PSMA8 primary antibodies
  • Description
    Mouse polyclonal to PSMA8
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cow, Chimpanzee, Cynomolgus Monkey, Rhesus monkey, Opossum
  • Immunogen

    Recombinant fragment corresponding to Human PSMA8 aa 143-243.
    Sequence:

    GFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAIASD SEAIKLAIKALLEVVQSGGRNIELAIIRRNQPLKMFSAKEVELYVTEIEK


    Database link: Q8TAA3

  • Positive control
    • U-2 OS cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab66148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Detects a band of approximately 29 kDa (predicted molecular weight: 29 kDa).
ELISA Use at an assay dependent dilution.

Target

  • FunctionThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity). This may be a testis-specific subunit.
  • Sequence similaritiesBelongs to the peptidase T1A family.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC26605 antibody
    • Proteasome subunit alpha type 7 like antibody
    • Proteasome subunit alpha type-7-like antibody
    • PSA7L_HUMAN antibody
    • PSMA 7L antibody
    • PSMA 8 antibody
    • PSMA7L antibody
    • PSMA8 antibody
    • PSMA8 proteasome (prosome macropain) subunit alpha type 8 antibody
    • PSMA8 proteasome subunit alpha type 8 antibody
    see all

Anti-PSMA8 antibody images

  • Anti-PSMA8 antibody (ab66148) at 1/500 dilution + U-2 OS cell lysate at 50 µg

    Secondary
    Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Predicted band size : 29 kDa
    Observed band size : 29 kDa

References for Anti-PSMA8 antibody (ab66148)

ab66148 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab66148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"